The short version of visceral adipose tissue fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2025-10-28. Anything still debated is marked as such rather than presented as settled.
Growth hormone released from the pituitary stimulates the liver and other tissues to produce insulin-like growth factor 1, a stable circulating protein that serves as a practical marker of activity. Clinical studies therefore track IGF-1 concentrations alongside the hormone itself, and they commonly measure body composition with imaging rather than relying on body weight alone. Visceral adipose tissue, the fat surrounding abdominal organs, is quantified by computed tomography in the studies that supported approval. Adverse effects reported in trials include injection-site reactions, joint pain, and increases in blood glucose, which is why monitoring accompanies use.
Questions remain about how much of the observed fat reduction reflects direct GHRH-receptor signaling versus the downstream growth hormone and IGF-1 surge. It is also unclear whether the compound produces meaningful benefit in populations without lipodystrophy, since trials in cognitive impairment did not reach their stated goals. Long-term effects on glucose metabolism and on cardiovascular outcomes are not fully characterized. Published work generally describes effects on surrogate markers rather than on hard clinical endpoints, and independent replication of some findings is limited.
Tesamorelin acts on the growth hormone-releasing hormone receptor, a G-protein-coupled receptor found on somatotroph cells in the anterior pituitary. Binding triggers a rise in intracellular cyclic AMP, which in turn opens ion channels and raises calcium concentrations, leading to release of stored growth hormone into the bloodstream. Because the peptide works through the same receptor as the body's own GHRH, the resulting secretion follows a pulsatile pattern rather than a continuous elevation. The N-terminal modification slows enzymatic breakdown, so the signal persists longer than it would with the unmodified hormone.
Tesamorelin is a synthetic peptide of forty-four amino acids whose sequence reproduces human growth hormone-releasing hormone. Its distinguishing feature sits at the amino terminus, where a trans-3-hexenoyl group replaces the free amine. That acylation slows cleavage by dipeptidyl peptidase IV, an enzyme that otherwise removes the first two residues and inactivates the natural hormone quickly. The modified peptide therefore persists longer in circulation while keeping the same receptor target. It is handled as a lyophilized solid and dissolved shortly before use.
Signaling begins at the GHRH receptor, a class B G protein-coupled receptor displayed on somatotroph cells of the anterior pituitary. Receptor occupancy activates Gs proteins, which raise adenylyl cyclase activity and intracellular cyclic AMP, in turn driving protein kinase A dependent pathways. The downstream output is synthesis and pulsatile secretion of growth hormone into the bloodstream. Hepatic tissue and peripheral sites respond by increasing insulin-like growth factor 1 production. Somatostatin and IGF-1 itself supply negative feedback that caps the size and duration of each secretory burst.
Metabolic interest in this compound centers on fat distribution rather than on hormone levels alone. Imaging trials in adults with excess abdominal fat report reductions in visceral adipose tissue, while subcutaneous depots change comparatively little. Growth hormone and IGF-1 are presumed to carry the effect, but the separate contribution of each is not firmly established. Whether these changes persist after treatment stops, and whether they alter longer-term health outcomes, remain open questions that published work does not answer consistently.
| Property | Value | Notes |
|---|---|---|
| Receptor target | Growth hormone-releasing hormone receptor | G-protein-coupled receptor expressed on pituitary somatotroph cells |
| Primary signaling route | Cyclic AMP and protein kinase A | Increases intracellular calcium and promotes hormone release |
| Downstream marker | Insulin-like growth factor 1 | Blood concentration used as an integrated activity indicator |
| Study endpoint | Change in visceral adipose tissue | Assessed with computed tomography in trial populations |
| Research status | Investigational outside the approved indication | Trials in cognitive impairment did not meet primary endpoints |
Assays for these markers differ in calibration and antibody specificity, so results from different platforms are not always interchangeable. Reported values can shift when a laboratory changes method, even without any biological change. Studies that span long periods or multiple sites often need cross-validation of assays. This methodological variability is a recognized limitation when comparing findings across published reports, and it remains a topic of ongoing standardization work.
Measuring the effect of a growth hormone-releasing hormone analogue requires markers that reflect pituitary output rather than the peptide itself. The two most frequently used are growth hormone and insulin-like growth factor 1. Growth hormone fluctuates sharply across the day and responds to sleep, stress, and meals, so isolated readings can be difficult to interpret. Insulin-like growth factor 1 changes more slowly and is often treated as the more stable integrated marker of axis activity.
Because growth hormone is released in pulses, single measurements can misrepresent overall secretion. Investigators sometimes use repeated sampling or overnight profiles to capture the pattern rather than a single value. Provocative testing, in which a stimulus is given and the response is tracked over time, offers another way to characterize the axis. Each approach carries trade-offs between sensitivity, burden on the participant, and the influence of non-target variables.
Tesamorelin is a synthetic analog of growth hormone-releasing hormone, a peptide hormone produced by the hypothalamus. The molecule retains the 44-amino-acid sequence of human GHRH and carries a trans-3-hexenoyl modification at its N-terminus. This modification increases resistance to enzymatic degradation and extends the peptide's functional stability relative to native GHRH. The compound is supplied as a lyophilized powder for reconstitution and subcutaneous administration in clinical settings. Its development code was TH9507, and it belongs to the GHRH analog class. It is not a growth hormone product; instead, it acts upstream to stimulate endogenous growth hormone release.
Clinical interest in tesamorelin arose from the need to address visceral adiposity in people living with HIV. Antiretroviral therapy improved survival but was associated in some patients with central fat accumulation, altered lipid profiles, and metabolic complications. This condition, often called HIV-associated lipodystrophy, involves excess visceral adipose tissue that is difficult to manage through diet and exercise alone. Investigators evaluated tesamorelin because GHRH analogs can stimulate growth hormone secretion and influence fat distribution without direct liposuction or invasive procedures.
A Phase 3 program led to regulatory approval in the United States in 2010 for reduction of excess visceral abdominal fat in adults with HIV and lipodystrophy. Subsequent studies examined effects on liver fat, muscle area, and metabolic markers, with mixed findings for some endpoints. Long-term cardiovascular outcomes and effects on mortality remain uncertain because most trials were relatively short and focused on imaging-based fat measurements. Use in populations without HIV has been studied experimentally but is not part of the approved indication.
Identity and purity are assessed with reversed-phase high-performance liquid chromatography, which separates the peptide from truncated or oxidized forms. Mass spectrometry confirms the expected molecular weight, and peptide mapping after enzymatic digestion verifies the amino acid sequence. Water content is measured because residual moisture affects stability, and tests for aggregates or particulates are standard for injectable peptides. Circular dichroism can indicate whether the molecule has adopted an unexpected secondary structure in solution.
Research supply is often accompanied by a certificate of analysis listing chromatographic purity, mass confirmation, and storage conditions. Laboratories compare that document with an independent test when material is intended for bench work, since certificates describe a batch rather than an individual vial. Published studies usually state the source and purity of the peptide because small differences in purity can shift measured activity. Full analytical validation is rarely reported, which leaves batch-to-batch comparability an open question.
The peptide is supplied as a lyophilized powder in single-use vials and is normally kept refrigerated between two and eight degrees Celsius, protected from light. Once dissolved, the solution is handled carefully because peptide bonds and the acyl modification can degrade under warm or alkaline conditions. Vials are inspected for cracks, and the powder is checked for color and uniformity before handling. Temperature excursions during shipping are a frequent reason for quality questions.
Alyx manages to derail the train sending Eli to Nova Prospekt before discovering that the Vault is actually a prison containing Gordon Freeman. When Alyx reaches the Vault, however, she instead finds the G-Man, who gives her a vision of her father's death in exchange for freeing him. He gives her the power to kill the Advisor, saving Eli's life, but puts her in stasis to replace Gordon Freeman, causing her to be removed from time. In 2020, an Alyx-inspired skin was added to the massive multiplayer online obstacle course battle royale game Fall Guys.
== Examples == Numerous endogenous compounds – including hormones, catecholamines such as dopamine and noradrenaline, and many trace amines (e.g. adrenaline, phenethylamine itself, tyramine, thyronamine, and iodothyronamine) – are substituted phenethylamines. Several notable recreational drugs, such as MDPV (Monkey Dust), MDMA (ecstasy), mescaline, methamphetamine, and cathinone, are also members of the class. Many well-known prescription drugs are from the phenylethylamine class such as Adderall which uses Amphetamine, Desoxyn which uses methamphetamine, and Sudafed which uses pseudoephedrine.
An explanation of this relation in terms of linear elasticity theory is problematic. Linear elasticity theory predicts that stress (and hence the strain) at the tip of a sharp flaw in a linear elastic material is infinite. To avoid that problem, Griffith developed a thermodynamic approach to explain the relation that he observed. The growth of a crack, the extension of the surfaces on either side of the crack, requires an increase in the surface energy. Griffith found an expression for the constant
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
== Oxygen-14 == Oxygen-14 (half-life 70.62 seconds) is the second most stable radioisotope of oxygen, and decays by positron emission to nitrogen-14. Oxygen-14 ion beams are of interest to researchers of proton-rich nuclei; for example, one early experiment at the Facility for Rare Isotope Beams in East Lansing, Michigan, produced a 14O beam by proton bombardment of 14N, using it to determine the absolute strength of the electron capture transition.
Those with mass 5 decay to helium-4 and a proton or a neutron, and those with mass 8 decay to two helium-4 nuclei; their half-lives (helium-5, lithium-5, and beryllium-8) are very short, unlike the half-lives for all other such nuclides with A ≤ 209, which are very long. (Such nuclides with A ≤ 209 are primordial nuclides except 146Sm.) Working out the details of the theory leads to an equation relating the half-life of a radioisotope to the decay energy of its alpha particles, a theoretical derivation of the empirical Geiger–Nuttall law.
== Baltimore Colts == The Baltimore Colts defensive line that included future Hall of Famers defensive end Gino Marchetti and tackle Art Donovan, along with end Don Joyce and tackle Eugene "Big Daddy" Lipscomb has also been referred to as the "'fearsome foursome'" by at least 1958. They have been called the prototype of defensive lines. In addition to Marchetti’s and Donovan’s Hall of Fame status, Lipscomb was first-team All-Pro in 1958 and 1959. Marchetti is considered among the greatest defensive ends in NFL history. The Colts won the 1958 and 1959 NFL championships over the New York Giants, the 1958 game being known as "The Greatest Game Ever Played". They played together as a line from 1956 to 1960, with defensive end Ordell Braase taking over as a starter for Joyce in 1960, and Lipscomb being traded to the Steelers before the start of the 1961 season.
Sources: en.wikipedia.org
== March 2013 reconstitution == Following the return of the government at the 2013 state election, held on 9 March, the Ministry was again reconstituted, and was sworn in on 21 March 2013. John Castrilli (Local Government; Heritage; Citizenship and Multicultural Interests) and the retiring Norman Moore (Mines and Petroleum; Fisheries; Electoral Affairs) both resigned their positions, while Simon O'Brien (Finance; Commerce; Small Business), Robyn McSweeney (Child Protection; Community Services; Seniors and Volunteering; Women's Interests; Youth), and Murray Cowper (Training and Workforce Development; Corrective Services) each lost their portfolios. Five new ministers were appointed, including four previous parliamentary secretaries, and seven new parliamentary secretaries were appointed, making eight in total. A new portfolio, that of Minister for Veterans, was created. The list below is ordered by decreasing seniority within the Cabinet, as indicated by the Government Gazette and the Hansard index. Blue entries indicate members of the Liberal Party, while green entries indicate members of the National Party.
==== Decline ==== By the end of the Song dynasty (1279 AD), acupuncture had lost much of its status in China. It became rarer in the following centuries, and was associated with less prestigious professions like alchemy, shamanism, midwifery and moxibustion. Additionally, by the 18th century, scientific rationality was becoming more popular than traditional superstitious beliefs. By 1757 a book documenting the history of Chinese medicine called acupuncture a "lost art". Its decline was attributed in part to the popularity of prescriptions and medications, as well as its association with the lower classes. In 1822, the Chinese Emperor signed a decree excluding the practice of acupuncture from the Imperial Medical Institute. He said it was unfit for practice by gentlemen-scholars. In China acupuncture was increasingly associated with lower-class, illiterate practitioners. It was restored for a time, but banned again in 1929 in favor of science-based medicine. Although acupuncture declined in China during this time period, it was also growing in popularity in other countries.
Absinthe has never been illegal to import or manufacture in Australia although importation requires a permit under the Customs (Prohibited Imports) Regulation 1956 due to a restriction on importing any product containing oil of wormwood. In 2000, an amendment made all wormwood species prohibited herbs for food purposes under Food Standard 1.4.4. Prohibited and Restricted Plants and Fungi. However, this amendment was found inconsistent with other parts of the pre-existing Food Code, and it was withdrawn in 2002 during the transition between the two codes, thereby continuing to allow absinthe manufacture and importation through the existing permit-based system. These events were erroneously reported by the media as it having been reclassified from a prohibited product to a restricted product.
Sources: en.wikipedia.org
It acts upstream at the pituitary receptor and depends on functioning somatotroph cells to produce any effect. Growth hormone injections bypass that step and deliver the hormone directly. The pharmacokinetic profiles and the resulting feedback on the body's own secretion therefore differ.
Insulin-like growth factor 1 is a downstream product of growth hormone action and changes more slowly than the hormone itself. Its blood concentration is used as an integrated indicator of whether the pathway has been stimulated. Interpretation requires attention to nutrition, illness, and other factors that shift IGF-1 independently.
No. The approved indication concerns excess visceral abdominal fat in adults with HIV infection and lipodystrophy, a specific clinical population. It is not cleared for general weight reduction or for cosmetic use. Studies in other groups remain investigational.
The amino acid sequence matches human growth hormone-releasing hormone, but the amino terminus carries a trans-3-hexenoyl group instead of a free amine. That single structural change chiefly affects enzymatic stability rather than receptor selectivity.